Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 62 (Gpr62)

This Recombinant Mouse Probable G-protein coupled receptor 62 (Gpr62) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 62

UniProt

Q80UC6

Expression Region

1-358

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANGSGLSVTELAGSVGFILAVLVEVGAVLGNGTLLVVVLRTPDLQDAFYLAHLCVVDLL AAASIMPLGLLAAPPGLGTVPLDPSSCRAARFLSAALLPACTLGVAALGLARYRLIVHPL RPGARPAPALVLTAVWSAAALLGALSLLGPPPAPPPAPARCSVLAGGLGPFRPLWAMLAF ALPALLLLAAYGSIFLVARRAALRPPRGTRPRSDSLDSRLSFLPPLRPRLLGGKAALAPA LAVGQFAACWLPYGCACLAPAARAAAAEATVTWVAYSAFAAHPFLYGLLQRPVRLALGRL TRRALPRAPKACTSQAWHLQTLLRRLQELRKDPVLGPSEAPEQARELARQTPSVSEAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit BTB/POZ domain containing adapter for CUL3 mediated RhoA degradation protein 1 (KCTD13) ELISA kit
GTR10450478 96 Well

Rabbit BTB/POZ domain containing adapter for CUL3 mediated RhoA degradation protein 1 (KCTD13) ELISA kit

Sign In for Pricing
View Details
CD63 Protein Vector (Rat) (pPB-C-His)
PV258678 500 ng

CD63 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti Chicken IgG
MBS536019-01 2 mg

Rabbit anti Chicken IgG

Sign In for Pricing
View Details
Rabbit anti Chicken IgG
MBS536019-02 5x 2 mg

Rabbit anti Chicken IgG

Sign In for Pricing
View Details
Lentiviral human TCTEX1D2 shRNA (UAS) - Lentiviral human TCTEX1D2 shRNA (UAS, RFP) plasmid
GTR15336448 1 Vial

Lentiviral human TCTEX1D2 shRNA (UAS) - Lentiviral human TCTEX1D2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Dog/Canine Dynamin 1 DNM1 ELISA Kit
BG-CAN10815 1 Each

Dog/Canine Dynamin 1 DNM1 ELISA Kit

Sign In for Pricing
View Details