Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 20 (Gpr20)

This Recombinant Mouse G-protein coupled receptor 20 (Gpr20) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

G-protein coupled receptor 20

UniProt

Q8BYC4

Expression Region

1-358

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSALSMRPWDAALPNTTAAAWTNGSVPEMPLFHHFARLDEELQATFPSLWQALMVVHGT IFLAGLVLNGLALYVFCCRTRAKTPSVTYTINLVVTDLLVGLSLPTRFAVFYGARGCLRC AFPHVLGYFLNMHCSILFLTCICVDRYLAIVQPEGSRRWRQPACAKAVCIFVWLAAGVVT LSVLGVKSGGRSCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQ LLLTVLVIFLVCFTPFHARQVAVALWPNVPKHTSLVAYHVAVTLSSLNSCMDPIVYCFIT SGFQATVRGLFYQRGEEFKPSSMDVVSMHKSTKASAPIHILSIGSHTLTQPLTNGPEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF-6 Mouse Monoclonal Antibody [A6A2]
HA600052 100 µL

eIF-6 Mouse Monoclonal Antibody [A6A2]

Sign In for Pricing
View Details
Cal-520®, potassium salt
21140-AAT 10x 50 µg

Cal-520®, potassium salt

Sign In for Pricing
View Details
SERPINB3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]
TA506885BM 100 µL

SERPINB3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]

Sign In for Pricing
View Details
Human RG9MTD2 (TRMT10A) activation kit by CRISPRa
GA114290 1 Kit

Human RG9MTD2 (TRMT10A) activation kit by CRISPRa

Sign In for Pricing
View Details
c Kit (KIT) (N-term) Rabbit Polyclonal Antibody
AP14374PU-N 400 µL

c Kit (KIT) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARHGDIA Polyclonal Antibody
E-AB-11263-01 20 µL

ARHGDIA Polyclonal Antibody

Sign In for Pricing
View Details