Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 20 (Gpr20)

This Recombinant Mouse G-protein coupled receptor 20 (Gpr20) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

G-protein coupled receptor 20

UniProt

Q8BYC4

Expression Region

1-358

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSALSMRPWDAALPNTTAAAWTNGSVPEMPLFHHFARLDEELQATFPSLWQALMVVHGT IFLAGLVLNGLALYVFCCRTRAKTPSVTYTINLVVTDLLVGLSLPTRFAVFYGARGCLRC AFPHVLGYFLNMHCSILFLTCICVDRYLAIVQPEGSRRWRQPACAKAVCIFVWLAAGVVT LSVLGVKSGGRSCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQ LLLTVLVIFLVCFTPFHARQVAVALWPNVPKHTSLVAYHVAVTLSSLNSCMDPIVYCFIT SGFQATVRGLFYQRGEEFKPSSMDVVSMHKSTKASAPIHILSIGSHTLTQPLTNGPEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM132A Human Gene Knockout Kit (CRISPR)
KN214846LP 1 Kit

TMEM132A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N,N-Diethylacetamidine Hydrochloride
TRC-N269258-1G 1 g

N,N-Diethylacetamidine Hydrochloride

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), 1mg/mL
BNUM1577-50 1x 50 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), 1mg/mL

Sign In for Pricing
View Details
FITC Anti-Human CD8 Antibody[UCHT-4]
AN00427C-01 20 Tests

FITC Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
FITC Anti-Human CD8 Antibody[UCHT-4]
AN00427C-02 100 Tests

FITC Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details
FITC Anti-Human CD8 Antibody[UCHT-4]
AN00427C-03 2x 100 Tests

FITC Anti-Human CD8 Antibody[UCHT-4]

Sign In for Pricing
View Details