Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7b (Taar7b)

This Recombinant Rat Trace amine-associated receptor 7b (Taar7b) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7b, TaR-7b, Trace amine receptor 7b, Trace amine receptor 12, TaR-12

UniProt

Q923X8

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDDRFPWDQDSILSRDLLSASSMQLCYEKLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDIYC KFHSSFDGSFCYSSIFHLCFISADRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSF SLFYTGVNEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNIEKMGKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FVTPTYVYEILVWIGYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1CB Recombinant Protein (Human)
RP024334 100 µg

PPP1CB Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-L3MBTL2 Antibody Picoband®, HRP Conjugate
A08416-1-HRP 100 µg/Vial

Anti-L3MBTL2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Dengue virus NS3 protein Antibody
OAGA07140-100UL 100 µL

Dengue virus NS3 protein Antibody

Sign In for Pricing
View Details
Cyclo (-Ala-Gln)
sc-285308 250 mg

Cyclo (-Ala-Gln)

Sign In for Pricing
View Details
EGF Receptor (phospho-Tyr1045) rabbit pAb
E013905 100 µg -100 µL

EGF Receptor (phospho-Tyr1045) rabbit pAb

Sign In for Pricing
View Details
2-Ethylhexyl trans-4-methoxycinnamate
orb1680099-01 100 mg

2-Ethylhexyl trans-4-methoxycinnamate

Sign In for Pricing
View Details