Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7b (Taar7b)

This Recombinant Rat Trace amine-associated receptor 7b (Taar7b) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7b, TaR-7b, Trace amine receptor 7b, Trace amine receptor 12, TaR-12

UniProt

Q923X8

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDDRFPWDQDSILSRDLLSASSMQLCYEKLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDIYC KFHSSFDGSFCYSSIFHLCFISADRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYSF SLFYTGVNEAGLEDLVSALTCVGGCQIAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAK QQAQNIEKMGKQTARASESYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FVTPTYVYEILVWIGYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EPS8 Protein Lysate 20ug
IHUEPS8PLLY20UG 20 µg

Human EPS8 Protein Lysate 20ug

Sign In for Pricing
View Details
Hrs-2 (HGS, Hepatocyte Growth Factor-regulated tyrosine kinase substrate2, Hrs2, SNAP-25 Interacting Protein Hrs-2) discontinued, see 301672
H7453-15 50 µg

Hrs-2 (HGS, Hepatocyte Growth Factor-regulated tyrosine kinase substrate2, Hrs2, SNAP-25 Interacting Protein Hrs-2) discontinued, see 301672

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 276 (CD276)
MBS2031024-01 0.01 mg

Recombinant Cluster Of Differentiation 276 (CD276)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 276 (CD276)
MBS2031024-02 0.05 mg

Recombinant Cluster Of Differentiation 276 (CD276)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 276 (CD276)
MBS2031024-03 0.1 mg

Recombinant Cluster Of Differentiation 276 (CD276)

Sign In for Pricing
View Details
Recombinant Cluster Of Differentiation 276 (CD276)
MBS2031024-04 0.2 mg

Recombinant Cluster Of Differentiation 276 (CD276)

Sign In for Pricing
View Details