Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7e (Taar7e)

This Recombinant Rat Trace amine-associated receptor 7e (Taar7e) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7e, TaR-7e, Trace amine receptor 7e, Trace amine receptor 14, TaR-14

UniProt

Q923X6

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDASFPWDQDSILSRDLLSALSSQLCYENLNRSCIRSPYSPGPRLILHAVFGFSAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDIYC KFHSSFDVSFCYSSIFHLCFISVDRYIAVSDPLIYLTRFTASVSGKCITFSWFLSIIYSF SLLYTGASEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLVPTLVMMTVYSKVFLIAK QQAQNIEKIGKQTARASESYKDRVAKRERKAAKTLGITVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-glycosylase/DNA lyase
MBS2889165 Inquire

N-glycosylase/DNA lyase

Sign In for Pricing
View Details
CCNB2 Antibody (Phospho-Thr359)
OAAB16389-400UL 400 µL

CCNB2 Antibody (Phospho-Thr359)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Orotate phosphoribosyltransferase (pyrE)
MBS1090678-01 0.02 mg (E-Coli)

Recombinant Pectobacterium carotovorum subsp. carotovorum Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Orotate phosphoribosyltransferase (pyrE)
MBS1090678-02 0.1 mg (E-Coli)

Recombinant Pectobacterium carotovorum subsp. carotovorum Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Orotate phosphoribosyltransferase (pyrE)
MBS1090678-03 0.02 mg (Yeast)

Recombinant Pectobacterium carotovorum subsp. carotovorum Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Orotate phosphoribosyltransferase (pyrE)
MBS1090678-04 0.1 mg (Yeast)

Recombinant Pectobacterium carotovorum subsp. carotovorum Orotate phosphoribosyltransferase (pyrE)

Sign In for Pricing
View Details