Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7e (Taar7e)

This Recombinant Rat Trace amine-associated receptor 7e (Taar7e) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7e, TaR-7e, Trace amine receptor 7e, Trace amine receptor 14, TaR-14

UniProt

Q923X6

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDASFPWDQDSILSRDLLSALSSQLCYENLNRSCIRSPYSPGPRLILHAVFGFSAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDIYC KFHSSFDVSFCYSSIFHLCFISVDRYIAVSDPLIYLTRFTASVSGKCITFSWFLSIIYSF SLLYTGASEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLVPTLVMMTVYSKVFLIAK QQAQNIEKIGKQTARASESYKDRVAKRERKAAKTLGITVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILRENSSATNLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/iFluor® 700 Anti-human CD42b Antibody *HIP1*
104201X0-AAT 25 Tests

PE/iFluor® 700 Anti-human CD42b Antibody *HIP1*

Sign In for Pricing
View Details
Horse IgA ((Immunoglobulin A) ELISA Kit
EHS0056 96 Tests

Horse IgA ((Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
Olfr677-set siRNA/shRNA/RNAi Lentivector (Mouse)
33354094 4x 500 ng

Olfr677-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse RNF115 Protein, His (Fc)-Avi-tagged
RNF115-7643M 50 µg

Recombinant Mouse RNF115 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CHMP1B (D-10) Alexa Fluor® 546
sc-514013 AF546 200 µg/mL

CHMP1B (D-10) Alexa Fluor® 546

Sign In for Pricing
View Details
UCKL1 (Uridine-cytidine Kinase-like 1, UCK1L, URKL1, UCK1-LIKE) (MaxLight 550)
MBS6442442-01 0.1 mL

UCKL1 (Uridine-cytidine Kinase-like 1, UCK1L, URKL1, UCK1-LIKE) (MaxLight 550)

Sign In for Pricing
View Details