Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7h (Taar7h)

This Recombinant Rat Trace amine-associated receptor 7h (Taar7h) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7h, TaR-7h, Trace amine receptor 7h, Trace amine receptor 6, TaR-6

UniProt

Q923Y4

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATDDESFPWDQDSILSRDLLSALSPQLCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDSYC KLHTSFDMSFCCSSLLHLCFISVDRYIAVSDPLIYPIRFTASVSGKCITFSWFLSIIYGF SLIYTGASEAGLKDLVSALSCVGGCQIPMNQSCVLINFLLFLVPTLVMMTVYSKIFLIAK QQAQNMEKMSKQTTRASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYLIDSIIDAFLG FITPSYVYEILVWIVYYNSAMNPLIYAFFYPWFRNAIKLIVTGKILKQNSSTTNLFSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CNN1/832), CF488A conjugate, 0.1mg/mL
BNC880832-500 1x 500 µL

Calponin-1 (CNN1/832), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF740 conjugate, 0.1mg/mL
BNC741907-100 1x 100 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1b (RIV12), CF405S conjugate, 0.1mg/mL
BNC040317-100 1x 100 µL

CD1b (RIV12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details