Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7d (Taar7d)

This Recombinant Rat Trace amine-associated receptor 7d (Taar7d) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7d, TaR-7d, Trace amine receptor 7d, Trace amine receptor 15, TaR-15

UniProt

Q923X5

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVDDDRFPWDQDSILSRDLLSASSLQLCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLMVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDTYC KLHTCFDVSFCYCSLFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYGF PLIYTGASEAGLEDLVSALTCVGGCQIPMNQKFVLINFLLFLVPTLVMMTVYSKIFLIAR QQAQNIEKMRKQTARASESYKDRVCKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILIWIVYYNSSMNPLIYAFFYPWFRKATKLIVTGKILRENSSTINLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cy5.5 Anti-human CD161 Antibody *HP-3G10*
116101U2-AAT 500 Tests

PerCP/Cy5.5 Anti-human CD161 Antibody *HP-3G10*

Sign In for Pricing
View Details
Recombinant Human POTEG, N-His
MBS1574891-01 0.1 mg

Recombinant Human POTEG, N-His

Sign In for Pricing
View Details
Recombinant Human POTEG, N-His
MBS1574891-02 1 mg

Recombinant Human POTEG, N-His

Sign In for Pricing
View Details
Recombinant Human POTEG, N-His
MBS1574891-03 5x 1 mg

Recombinant Human POTEG, N-His

Sign In for Pricing
View Details
Pig Apelin (APLN) ELISA Kit
AE61757PI-01 48 Tests

Pig Apelin (APLN) ELISA Kit

Sign In for Pricing
View Details
Pig Apelin (APLN) ELISA Kit
AE61757PI-02 96 Tests

Pig Apelin (APLN) ELISA Kit

Sign In for Pricing
View Details