Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Trace amine-associated receptor 7d (Taar7d)

This Recombinant Rat Trace amine-associated receptor 7d (Taar7d) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Trace amine-associated receptor 7d, TaR-7d, Trace amine receptor 7d, Trace amine receptor 15, TaR-15

UniProt

Q923X5

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRVDDDRFPWDQDSILSRDLLSASSLQLCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLMVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSMVRSVEGCWYFGDTYC KLHTCFDVSFCYCSLFHLCFISVDRYIAVSDPLIYPTRFTASVSGKCITFSWLLSIIYGF PLIYTGASEAGLEDLVSALTCVGGCQIPMNQKFVLINFLLFLVPTLVMMTVYSKIFLIAR QQAQNIEKMRKQTARASESYKDRVCKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILIWIVYYNSSMNPLIYAFFYPWFRKATKLIVTGKILRENSSTINLFPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS516841 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
CD49d Mouse mAb
orb2714291-01 50 µL

CD49d Mouse mAb

Sign In for Pricing
View Details
CD49d Mouse mAb
orb2714291-02 100 µL

CD49d Mouse mAb

Sign In for Pricing
View Details
Influenza B (Type B Virus, Flu B) (Biotin)
MBS6261563-01 0.1 mL

Influenza B (Type B Virus, Flu B) (Biotin)

Sign In for Pricing
View Details
Influenza B (Type B Virus, Flu B) (Biotin)
MBS6261563-02 5x 0.1 mL

Influenza B (Type B Virus, Flu B) (Biotin)

Sign In for Pricing
View Details
PLV3-U6-ALDH1A1 (human) -sgRNA1-Cas9-Puro
BZ55010 1 Vial

PLV3-U6-ALDH1A1 (human) -sgRNA1-Cas9-Puro

Sign In for Pricing
View Details