Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 87 (Gpr87)

This Recombinant Mouse G-protein coupled receptor 87 (Gpr87) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

G-protein coupled receptor 87

UniProt

Q99MT7

Expression Region

1-358

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLNLTLTKLPGNELYSQASHTANSTSEGHGKNSTLHNKFDTIILPVLYLVIFVASILLN GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVRDAGFGPWYFEFILCRYTSVL FYANMYTSIVFLGLISVDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAILSLPNIILT NGQPTKENIHDCMKLKSPLGAKWHMAVTYVDSCLFVAVLVILIGCYIAISRYIHKSSRQF ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSNLDRLLDESAHKILYYCKEMTL FLSACNVCLDPIIYFFMCKSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABARAP/L1/L2 Triple Knockout HeLa Cell Line (GBRP TKO)
T3465 1x106 cells / 1.0 mL

GABARAP/L1/L2 Triple Knockout HeLa Cell Line (GBRP TKO)

Sign In for Pricing
View Details
Keratin 33A Lentiviral Activation Particles (h)
sc-410858-LAC 200 µL

Keratin 33A Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
OR7E37P sgRNA CRISPR Lentivector (Human) (Target 3)
K1535404 1.0 µg DNA

OR7E37P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Compound F0401-0089
MBS5801387 Inquire

Compound F0401-0089

Sign In for Pricing
View Details
Rabbit Polyclonal LC3A Antibody
NBP2-24394 0.1 mg

Rabbit Polyclonal LC3A Antibody

Sign In for Pricing
View Details
ACE Antibody (CT)
6703-100 100 µL

ACE Antibody (CT)

Sign In for Pricing
View Details