Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 87 (Gpr87)

This Recombinant Mouse G-protein coupled receptor 87 (Gpr87) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

G-protein coupled receptor 87

UniProt

Q99MT7

Expression Region

1-358

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLNLTLTKLPGNELYSQASHTANSTSEGHGKNSTLHNKFDTIILPVLYLVIFVASILLN GLAVWIFFHIRNKTSFIFYLKNIVVADLIMTLTFPFRIVRDAGFGPWYFEFILCRYTSVL FYANMYTSIVFLGLISVDRYLKVVKPFGDSRMYSITFTKVLSVCVWVIMAILSLPNIILT NGQPTKENIHDCMKLKSPLGAKWHMAVTYVDSCLFVAVLVILIGCYIAISRYIHKSSRQF ISQSSRKRKHNQSIRVVVAVFFTCFLPYHLCRIPFTFSNLDRLLDESAHKILYYCKEMTL FLSACNVCLDPIIYFFMCKSFSRRLFKKSNIRTRSESIRSLQSVRRSEVRIYYDYTDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IGF1R (IGF-1 Receptor) ELISA Kit
ER1991 96 Tests

Rat IGF1R (IGF-1 Receptor) ELISA Kit

Sign In for Pricing
View Details
Heterochromatin-associated protein MENT
AP87695-01 50 µg

Heterochromatin-associated protein MENT

Sign In for Pricing
View Details
Heterochromatin-associated protein MENT
AP87695-02 100 µg

Heterochromatin-associated protein MENT

Sign In for Pricing
View Details
Heterochromatin-associated protein MENT
AP87695-03 1 mg

Heterochromatin-associated protein MENT

Sign In for Pricing
View Details
HIST1H3A Antibody
orb418639-01 50 μL

HIST1H3A Antibody

Sign In for Pricing
View Details
HIST1H3A Antibody
orb418639-02 100 µL

HIST1H3A Antibody

Sign In for Pricing
View Details