Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Histamine H2 receptor (Hrh2)

This Recombinant Rat Histamine H2 receptor (Hrh2) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Histamine H2 receptor, H2R, HH2R, Gastric receptor I

UniProt

P25102

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPNGTVHSCCLDSMALKVTISVVLTTLILITIAGNVVVCLAVSLNRRLRSLTNCFIVSL AATDLLLGLLVLPFSAIYQLSFTWSFGHVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV YGLVDGLVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG AFIICWFPYFTAFVYRGLRGDDAINEAVEGIVLWLGYANSALNPILYAALNRDFRTAYQQ LFHCKFASHNSHKTSLRLNNSLLPRSQSREGRWQEEKPLKLQVWSGTELTHPQGNPIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Scand1 Pre-designed siRNA Set B
SI212457B 1 Each

Rat Scand1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
(17Alpha)-17-Hydroxy-19-norpregn-5-en-20-yn-3-one Cyclic 1,2-Ethanediyl Acetal
TRC-H949000-250MG 250 mg

(17Alpha)-17-Hydroxy-19-norpregn-5-en-20-yn-3-one Cyclic 1,2-Ethanediyl Acetal

Sign In for Pricing
View Details
Recombinant Human C1S Protein, His (Fc)-Avi-tagged
C1S-2572H 50 µg

Recombinant Human C1S Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
PEG3 Rabbit pAb, PerCP-Cy7 conjugated
orb2852224 100 µL

PEG3 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Isyna1 AAV siRNA Pooled Vector
25139164 1.0 µg

Isyna1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CYLC2 Recombinant Protein (Human)
RP038377 100 µg

CYLC2 Recombinant Protein (Human)

Sign In for Pricing
View Details