Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Histamine H2 receptor (Hrh2)

This Recombinant Rat Histamine H2 receptor (Hrh2) spans the amino acid sequence from region 1-358.

Product Specifications

Product Name Alternative

Histamine H2 receptor, H2R, HH2R, Gastric receptor I

UniProt

P25102

Expression Region

1-358

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPNGTVHSCCLDSMALKVTISVVLTTLILITIAGNVVVCLAVSLNRRLRSLTNCFIVSL AATDLLLGLLVLPFSAIYQLSFTWSFGHVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLVTPVRVAISLVFIWVISITLSFLSIHLGWNSRNGTRGGNDTFKCKVQVNEV YGLVDGLVTFYLPLLIMCVTYYRIFKIAREQAKRINHISSWKAATIREHKATVTLAAVMG AFIICWFPYFTAFVYRGLRGDDAINEAVEGIVLWLGYANSALNPILYAALNRDFRTAYQQ LFHCKFASHNSHKTSLRLNNSLLPRSQSREGRWQEEKPLKLQVWSGTELTHPQGNPIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Herpes Simplex Virus 6 IgM Antibody ELISA Kit
MBS3802184-01 48 Well

Human Herpes Simplex Virus 6 IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Herpes Simplex Virus 6 IgM Antibody ELISA Kit
MBS3802184-02 96 Well

Human Herpes Simplex Virus 6 IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Herpes Simplex Virus 6 IgM Antibody ELISA Kit
MBS3802184-03 5x 96 Well

Human Herpes Simplex Virus 6 IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Herpes Simplex Virus 6 IgM Antibody ELISA Kit
MBS3802184-04 10x 96 Well

Human Herpes Simplex Virus 6 IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Phospho-Cortactin (Tyr421) Rabbit Polyclonal Antibody (BF750)
orb2519131 100 µL

Phospho-Cortactin (Tyr421) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Nr4a2 Mouse shRNA Lentiviral Particle (Locus ID 18227)
TL501521V 500 µL Each

Nr4a2 Mouse shRNA Lentiviral Particle (Locus ID 18227)

Sign In for Pricing
View Details