Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-33 (sre-33)

This Recombinant Serpentine receptor class epsilon-33 (sre-33) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-33, Protein sre-33

UniProt

O18175

Expression Region

1-359

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIINSNSSTIFSSIWLPVFFYVEPLDQQVIISILELMIYLVCIHLVNVSLHVALKIRLFH RNLYILALPMFGMWYELIIGKFITIAYRLKLLGLDFELGEHTAIWTNDPGKVLLVASLNG LELLIFGGFLQWHYMYSWIFGVLTVAVERVIASVLIENYESNTQNLMPAILLIISQFLSI SMAFGLLFQKVGPLSAHFPWMISCPISVAAYVFVKKVNESFRREIKNPGRKRIFTLSQQF QVKENLRVLHLGTRLVFAVLSFIGICGCGIAALHYKIVPSYYCHLIENVLFLNPFLIGLT AMLSIPQWKEQFMKSFLTVRLFRNRRKPVHIVVEIEECAKKKNDVETNLYFKQLANSWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CADM3 (NM_001127173) Human Recombinant Protein
TP720367L 500 µg

CADM3 (NM_001127173) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human ELK1 Protein (His & GST Tag)
PKSH030803 100 µg

Recombinant Human ELK1 Protein (His & GST Tag)

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF647 conjugate, 0.1mg/mL
BNC472730-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IGHD/2730R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSMB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C1]
TA803526AM 100 µL

MSMB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C1]

Sign In for Pricing
View Details
Psg16 Mouse Gene Knockout Kit (CRISPR)
KN514074 1 Kit

Psg16 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lung: left upper lobe
CR560611 5 µg

Tissue Total RNA, Lung: left upper lobe

Sign In for Pricing
View Details