Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-33 (sre-33)

This Recombinant Serpentine receptor class epsilon-33 (sre-33) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-33, Protein sre-33

UniProt

O18175

Expression Region

1-359

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIINSNSSTIFSSIWLPVFFYVEPLDQQVIISILELMIYLVCIHLVNVSLHVALKIRLFH RNLYILALPMFGMWYELIIGKFITIAYRLKLLGLDFELGEHTAIWTNDPGKVLLVASLNG LELLIFGGFLQWHYMYSWIFGVLTVAVERVIASVLIENYESNTQNLMPAILLIISQFLSI SMAFGLLFQKVGPLSAHFPWMISCPISVAAYVFVKKVNESFRREIKNPGRKRIFTLSQQF QVKENLRVLHLGTRLVFAVLSFIGICGCGIAALHYKIVPSYYCHLIENVLFLNPFLIGLT AMLSIPQWKEQFMKSFLTVRLFRNRRKPVHIVVEIEECAKKKNDVETNLYFKQLANSWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35A2 (NM_001032289) Human Over-expression Lysate
LC422299 20 µg

SLC35A2 (NM_001032289) Human Over-expression Lysate

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), CF405S conjugate, 0.1mg/mL
BNC040784-500 1x 500 µL

CD56 / NCAM (NCAM1/784), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF740 conjugate, 0.1mg/mL
BNC741757-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (C4/206), CF488A conjugate, 0.1mg/mL
BNC880206-100 1x 100 µL

CD4 (C4/206), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF647 conjugate, 0.1mg/mL
BNC472564-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2564R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclopentyl Chloride
TRC-C992335-5ML 5 mL

Cyclopentyl Chloride

Sign In for Pricing
View Details