Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-13 (sre-13)

This Recombinant Serpentine receptor class epsilon-13 (sre-13) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-13, Protein sre-13

UniProt

O45300

Expression Region

1-359

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFNISQENEFQTMYIKYFNKTYSIIEGSYNYYLFVFYIQIALIFIVLFYYLLNVYIDIK TCQFSTNTQKIHHAIYLPCVLGHVMCLIQKILLIKDSPAGDDMTNPVFYYISLFRAIFCF PGFYCLSAFVAERWFATYFLNDYEKNQRTWLVGLILWIIYSIAFISALDFHTAPSTVIHV TIFILLSCLAYLSNYLNFLLNRSYYYKSNRSDGGGYSLAQRFQISDNIRFSFFFNRLALS IAFFQISGPMCLLIDNLNISRSWKNLNTVVFDTILLLYAIVTPFVIYHHNPKYRTELQKI ANSIRNIRVRTNKNQIMPMDSLDESFNSLRIQDTFGKTIVFNVTEQTSTYFEKLDRAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C7orf63 (CFAP69) Human Gene Knockout Kit (CRISPR)
KN421781 1 Kit

C7orf63 (CFAP69) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sample Concentrator BCON-109
BCON-109 1 Unit

Sample Concentrator BCON-109

Sign In for Pricing
View Details
SIVA (SIVA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E4]
TA506824BM 100 µL

SIVA (SIVA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E4]

Sign In for Pricing
View Details
Phospho-Histone H2A.X (S139) Recombinant Rabbit monoclonal Antibody
HA750034 100 µL

Phospho-Histone H2A.X (S139) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ap5m1 Mouse Gene Knockout Kit (CRISPR)
KN501376 1 Kit

Ap5m1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DYRK1B (NM_004714) Human Over-expression Lysate
LC401491 20 µg

DYRK1B (NM_004714) Human Over-expression Lysate

Sign In for Pricing
View Details