Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-13 (sre-13)

This Recombinant Serpentine receptor class epsilon-13 (sre-13) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-13, Protein sre-13

UniProt

O45300

Expression Region

1-359

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFNISQENEFQTMYIKYFNKTYSIIEGSYNYYLFVFYIQIALIFIVLFYYLLNVYIDIK TCQFSTNTQKIHHAIYLPCVLGHVMCLIQKILLIKDSPAGDDMTNPVFYYISLFRAIFCF PGFYCLSAFVAERWFATYFLNDYEKNQRTWLVGLILWIIYSIAFISALDFHTAPSTVIHV TIFILLSCLAYLSNYLNFLLNRSYYYKSNRSDGGGYSLAQRFQISDNIRFSFFFNRLALS IAFFQISGPMCLLIDNLNISRSWKNLNTVVFDTILLLYAIVTPFVIYHHNPKYRTELQKI ANSIRNIRVRTNKNQIMPMDSLDESFNSLRIQDTFGKTIVFNVTEQTSTYFEKLDRAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS29P20 ORF Vector (Human) (pORF)
ORF031547 1.0 µg DNA

RPS29P20 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Dock6 ORF Vector (Mouse) (pORF)
ORF043268 1.0 µg DNA

Dock6 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
LEP (Leptin) Chicken ELISA Kit
E6218 96 Tests

LEP (Leptin) Chicken ELISA Kit

Sign In for Pricing
View Details
Donkey Lymphocyte Function Associated Antigen 1 (LFA1) ELISA Kit
MBS9344224 Inquire

Donkey Lymphocyte Function Associated Antigen 1 (LFA1) ELISA Kit

Sign In for Pricing
View Details
TUBA1A CRISPRa sgRNA lentivector (set of three targets)(Human)
48791121 3x 1.0µg DNA

TUBA1A CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
CNNM4 Knockout MCF7 Polyclonal Cells
ARG11412 1 Million

CNNM4 Knockout MCF7 Polyclonal Cells

Sign In for Pricing
View Details