Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-13 (sre-13)

This Recombinant Serpentine receptor class epsilon-13 (sre-13) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-13, Protein sre-13

UniProt

O45300

Expression Region

1-359

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFNISQENEFQTMYIKYFNKTYSIIEGSYNYYLFVFYIQIALIFIVLFYYLLNVYIDIK TCQFSTNTQKIHHAIYLPCVLGHVMCLIQKILLIKDSPAGDDMTNPVFYYISLFRAIFCF PGFYCLSAFVAERWFATYFLNDYEKNQRTWLVGLILWIIYSIAFISALDFHTAPSTVIHV TIFILLSCLAYLSNYLNFLLNRSYYYKSNRSDGGGYSLAQRFQISDNIRFSFFFNRLALS IAFFQISGPMCLLIDNLNISRSWKNLNTVVFDTILLLYAIVTPFVIYHHNPKYRTELQKI ANSIRNIRVRTNKNQIMPMDSLDESFNSLRIQDTFGKTIVFNVTEQTSTYFEKLDRAWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syt17 (NM_138649) Mouse Tagged Lenti ORF Clone
MR220469L4 10 µg

Syt17 (NM_138649) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit
MBS2505061-01 24 Tests

Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit

Sign In for Pricing
View Details
Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit
MBS2505061-02 48 Tests

Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit

Sign In for Pricing
View Details
Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit
MBS2505061-03 96 Tests

Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit

Sign In for Pricing
View Details
Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit
MBS2505061-04 5x 96 Tests

Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit

Sign In for Pricing
View Details
Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit
MBS2505061-05 10x 96 Tests

Monkey AGR2 (Anterior Gradient Protein 2) ELISA Kit

Sign In for Pricing
View Details