Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-26 (sre-26)

This Recombinant Serpentine receptor class epsilon-26 (sre-26) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-26, Protein sre-26

UniProt

O62489

Expression Region

1-359

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIKLSSTNSTSIFWLPIFFYNEPYWAQCAISSAELPFYMLSAYVVFVSCRIMLKIQLFH DNLMYIGVPMFGSWFLLIAGKLITILYRVRILNVESVKIHENWVFWTDEPEKMLNVQSLD GLVPLLVAGFLEIHFGFSVIFVGLAIVTERVIASMLIDNYEQSTSLLIPISFIIIYQFLA ISISLGILFNILGLYVLNASWILCILIGTIMYYYIRKINTKWLQEMQNPNRKRVFTVSQQ FQVRENLGAIAIGKRLVFVVLATIVVMGFGIVALVLEITVLFFMHFGENTLFCYPLYIFL VVMNGHPAWKQEFRKYFPKIKIFKKVRPGLVSVEIVEDQKKKLSLETDTYFRQLKSAWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6b-Chloro-17-acetoxy Progesterone
TRC-C363285-50MG 50 mg

6b-Chloro-17-acetoxy Progesterone

Sign In for Pricing
View Details
PHLDA1 Mouse Monoclonal Antibody [Clone ID: OTI4G2]
CF810938 100 µg

PHLDA1 Mouse Monoclonal Antibody [Clone ID: OTI4G2]

Sign In for Pricing
View Details
Dolichos biflorus Gel -DBA- Immobilized Lectin
AK-1201-2 2 mL

Dolichos biflorus Gel -DBA- Immobilized Lectin

Sign In for Pricing
View Details
C1orf131 (NM_152379) Human Recombinant Protein
TP307816L 1 mg

C1orf131 (NM_152379) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant CTBP2 Antibody
RC-5672-01 50 μL

Recombinant CTBP2 Antibody

Sign In for Pricing
View Details
Recombinant CTBP2 Antibody
RC-5672-02 100 µL

Recombinant CTBP2 Antibody

Sign In for Pricing
View Details