Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-26 (sre-26)

This Recombinant Serpentine receptor class epsilon-26 (sre-26) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-26, Protein sre-26

UniProt

O62489

Expression Region

1-359

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIKLSSTNSTSIFWLPIFFYNEPYWAQCAISSAELPFYMLSAYVVFVSCRIMLKIQLFH DNLMYIGVPMFGSWFLLIAGKLITILYRVRILNVESVKIHENWVFWTDEPEKMLNVQSLD GLVPLLVAGFLEIHFGFSVIFVGLAIVTERVIASMLIDNYEQSTSLLIPISFIIIYQFLA ISISLGILFNILGLYVLNASWILCILIGTIMYYYIRKINTKWLQEMQNPNRKRVFTVSQQ FQVRENLGAIAIGKRLVFVVLATIVVMGFGIVALVLEITVLFFMHFGENTLFCYPLYIFL VVMNGHPAWKQEFRKYFPKIKIFKKVRPGLVSVEIVEDQKKKLSLETDTYFRQLKSAWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KMT5A (NM_020382) Human Over-expression Lysate
LC402778 20 µg

KMT5A (NM_020382) Human Over-expression Lysate

Sign In for Pricing
View Details
ETS1 (Marker of Tumor Metastasis) (ETS1/1801), 0.2mg/mL
BNUB1801-500 1x 500 µL

ETS1 (Marker of Tumor Metastasis) (ETS1/1801), 0.2mg/mL

Sign In for Pricing
View Details
GDF3 Rabbit Monoclonal Antibody
TA423818 100 µL

GDF3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LysoViewTM 594, 1000X in DMSO, Trial Size
#70084-T 1x 10 µL

LysoViewTM 594, 1000X in DMSO, Trial Size

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF568 conjugate, 0.1mg/mL
BNC681825-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sct (BC048484) Mouse Tagged ORF Clone
MG200869 10 µg

Sct (BC048484) Mouse Tagged ORF Clone

Sign In for Pricing
View Details