Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (slc35b2)

This Recombinant Dictyostelium discoideum Adenosine 3'-phospho 5'-phosphosulfate transporter 1 (slc35b2) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Adenosine 3'-phospho 5'-phosphosulfate transporter 1, PAPS transporter 1, Solute carrier family 35 member B2

UniProt

Q55DM5

Expression Region

1-359

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Cancer Biology; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSGIEVNDSSTTNSNNNEKVQLSYNMKLALATGGIMGSFLLYGILQERLMVVPYKNADG SEEYFTDSTFLVLSNRVFAALMAIVIVLKRGESLKNVAPLHKYVGVALSNFCATWCQYEA LKYVNFPTQTLGKCGKMLPVMLVGTFISGKKYGLKDYSIALTITTGCMIFFLTGKISNNE SSNTSYGIILMALYMFFDSFTSTFQEKMFKGYTMSTYDQMIYVNGCSSIISVFILILNGR LFPAIEFISTHNGVFFDSTMLSASAGLGQMVIYYTIKEFGALVFSTIMVTRQMVSIILST LIYLHPLSNTQWIGALLVFGTLYYKSIEDSKKKHGGHSHGGSNAATTTTPSNNSNNTEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dcaf4 3'UTR GFP Stable Cell Line
TU154881 1.0 mL

Dcaf4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Kallikrein 7, ID (KLK7, PRSS6, SCCE, Kallikrein-7, Serine protease 6, Stratum corneum chymotryptic enzyme) (Azide free) (HRP)
MBS6312042-01 0.2 mL

Kallikrein 7, ID (KLK7, PRSS6, SCCE, Kallikrein-7, Serine protease 6, Stratum corneum chymotryptic enzyme) (Azide free) (HRP)

Sign In for Pricing
View Details
Kallikrein 7, ID (KLK7, PRSS6, SCCE, Kallikrein-7, Serine protease 6, Stratum corneum chymotryptic enzyme) (Azide free) (HRP)
MBS6312042-02 5x 0.2 mL

Kallikrein 7, ID (KLK7, PRSS6, SCCE, Kallikrein-7, Serine protease 6, Stratum corneum chymotryptic enzyme) (Azide free) (HRP)

Sign In for Pricing
View Details
Anti-TAS1R2 Antibody Picoband®, Dylight550 Conjugate
A08729-2-Dylight550 100 µg

Anti-TAS1R2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
GCOM1 (MYZAP) Human qPCR Template Standard (NM_152451)
HK211895 1 Kit

GCOM1 (MYZAP) Human qPCR Template Standard (NM_152451)

Sign In for Pricing
View Details
Anti-CCNE2 antibody
STJ116021 100 µl

Anti-CCNE2 antibody

Sign In for Pricing
View Details