Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog C-C chemokine receptor type 3 (CCR3)

This Recombinant Dog C-C chemokine receptor type 3 (CCR3) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

C-C chemokine receptor type 3, C-C CKR-3, CC-CKR-3, CCR-3, CCR3, CKR3, CD_antigen= CD193

UniProt

Q64H34

Expression Region

1-359

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEATTAEIKTMDESIQTTVFDYENSLPCEKVNIKHLGAQFLPPLYSLVFVIGLLGNVVVV VILTKYKRLWIMTNIFLLNLAISDLLFLFTLVFWIHYTGWNDWVFGRSMCKLISGLYYLG LYGEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSVLTWGLAGLAALPEFIFHESQK ESEQFVCTPLYPKDQEDNWKRFHALRMNILGLALPLLIMVVCYSGIIKTLLRCPSKKKYK AIRLIFVIMVVFFIFWTPYNLVLLLSAFQTIFFETTCEQSKQLDVAMQITEVIAYTHCCI NPIIYAFVGERFRKHLCHFFRRNVATYLGKYIPFLPSEKLERSSSVSPSTGEQEFSFVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
BNC880158-500 1x 500 µL

Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-100 1x 100 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL
BNC940460-500 1x 500 µL

CD44 Standard (156-3C11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL
BNC040029-100 1x 100 µL

Fibronectin (TV-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details