Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8S1 (OR8S1)

This Recombinant Human Olfactory receptor 8S1 (OR8S1) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Olfactory receptor 8S1

UniProt

Q8NH09

Expression Region

1-359

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALGNHSTITEFLLLGLSADPNIRALLFVLFLGIYLLTIMENLMLLLMIRADSCLHKPMY FFLSHLSFVDLCFSSVIVPKMLENLLSQRKTISVEGCLAQVFFVFVTAGTEACLLSGMAY DRHAAICRPLLYGQIMGKQLYMHLVWGSWGLGFLDALINVLLAVNMVFCEAKIIHHYSYE MPSLLPLSCSDISRSLIALLCSTLLHGLGNFLLVFLSYTRIISTILSISSTSGRSKAFST CSAHLTAVTLYYGSGLLRHLMPNSGSPIELIFSVQYTVVTPMLNSLIYSLKNKEVKGERS LRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQPQGACACSALRAAPTALP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Msrb3 (NM_177092) Mouse Untagged Clone
MC207957 10 µg

Msrb3 (NM_177092) Mouse Untagged Clone

Sign In for Pricing
View Details
Goat anti-TBC1D9 Antibody
MBS423365-01 0.1 mg

Goat anti-TBC1D9 Antibody

Sign In for Pricing
View Details
Goat anti-TBC1D9 Antibody
MBS423365-02 5x 0.1 mg

Goat anti-TBC1D9 Antibody

Sign In for Pricing
View Details
Maf, NT (Maf, Maf2, Transcription factor Maf, Proto-oncogene c-Maf, V-maf musculoaponeurotic fibrosarcoma oncogene homolog) (MaxLight 490) discontinued
038056-ML490 100 µL

Maf, NT (Maf, Maf2, Transcription factor Maf, Proto-oncogene c-Maf, V-maf musculoaponeurotic fibrosarcoma oncogene homolog) (MaxLight 490) discontinued

Sign In for Pricing
View Details
DGKZ Rabbit Polyclonal Antibody (Cy3)
orb985627 100 µL

DGKZ Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Shisa6-set siRNA/shRNA/RNAi Lentivector (Mouse)
43719094 4x 500 ng

Shisa6-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details