Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8S1 (OR8S1)

This Recombinant Human Olfactory receptor 8S1 (OR8S1) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Olfactory receptor 8S1

UniProt

Q8NH09

Expression Region

1-359

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALGNHSTITEFLLLGLSADPNIRALLFVLFLGIYLLTIMENLMLLLMIRADSCLHKPMY FFLSHLSFVDLCFSSVIVPKMLENLLSQRKTISVEGCLAQVFFVFVTAGTEACLLSGMAY DRHAAICRPLLYGQIMGKQLYMHLVWGSWGLGFLDALINVLLAVNMVFCEAKIIHHYSYE MPSLLPLSCSDISRSLIALLCSTLLHGLGNFLLVFLSYTRIISTILSISSTSGRSKAFST CSAHLTAVTLYYGSGLLRHLMPNSGSPIELIFSVQYTVVTPMLNSLIYSLKNKEVKGERS LRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTPQPQGACACSALRAAPTALP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJC22 siRNA (Rat)
CRR6135-01 15 nmol

DNAJC22 siRNA (Rat)

Sign In for Pricing
View Details
DNAJC22 siRNA (Rat)
CRR6135-02 30 nmol

DNAJC22 siRNA (Rat)

Sign In for Pricing
View Details
PTP4A1 siRNA Oligos set (Human)
38127171 3x 5 nmol

PTP4A1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
2- ((Methylamino) methyl) benzoic acid hydrochloride
OR1005498-01 100 mg

2- ((Methylamino) methyl) benzoic acid hydrochloride

Sign In for Pricing
View Details
2- ((Methylamino) methyl) benzoic acid hydrochloride
OR1005498-02 250 mg

2- ((Methylamino) methyl) benzoic acid hydrochloride

Sign In for Pricing
View Details
Bassoon Rabbit Polyclonal Antibody (BF488)
orb2559041 100 µL

Bassoon Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details