Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago hordei Pheromone receptor 1 (PRA1)

This Recombinant Ustilago hordei Pheromone receptor 1 (PRA1) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Pheromone receptor 1

UniProt

Q99063

Expression Region

1-359

Origin

Ustilago hordei (Smut fungus)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDHVTPFFALFACILVLFALGWHIRSRNVGTITLSLYLFFGNLDNFVNSVAWWSTAEDK APGFCEVSIRLRHALYIAIPASNLVIARKLESIASTRQVRASASEHKKSIIIDLLISVGL PVLYVSLMIVNQTNRYGIIEQVGCWPFLSLSWVWVLLVAAPVLIVSFASAVYSVLAFRWF WIRRRQFQAVLASSASTLNKARYIRLLVLTAIDMLLFFPIYVGSVSDTIRGAITTSYVSW SYVHTGFSYIPQFSAEVMEMQPSFKARLILSRLVCPISAYIFFAMFGLGQEARQGYKHAV LKALVFCKLRKERQKPIQNHIVANIEVVTFQSRETSGGIDGSPHSEKFSINTPTKYEEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6330403A02Rik Protein Vector (Mouse) (pPM-C-HA)
PV150128 500 ng

6330403A02Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
VPS13A CRISPR/Cas9 KO Plasmid (m)
sc-435447 20 µg

VPS13A CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Recombinant Human Vascular Endothelial Growth Factor receptor-2
7-04202 10 µg

Recombinant Human Vascular Endothelial Growth Factor receptor-2

Sign In for Pricing
View Details
KLHL15 Double Nickase Plasmid (h2)
sc-410478-NIC-2 20 µg

KLHL15 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Nelociguat 500mg
A20591-500 500 mg

Nelociguat 500mg

Sign In for Pricing
View Details
D-Luciferin, free acid
CHM-611-1g 1 g

D-Luciferin, free acid

Sign In for Pricing
View Details