Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago hordei Pheromone receptor 1 (PRA1)

This Recombinant Ustilago hordei Pheromone receptor 1 (PRA1) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Pheromone receptor 1

UniProt

Q99063

Expression Region

1-359

Origin

Ustilago hordei (Smut fungus)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDHVTPFFALFACILVLFALGWHIRSRNVGTITLSLYLFFGNLDNFVNSVAWWSTAEDK APGFCEVSIRLRHALYIAIPASNLVIARKLESIASTRQVRASASEHKKSIIIDLLISVGL PVLYVSLMIVNQTNRYGIIEQVGCWPFLSLSWVWVLLVAAPVLIVSFASAVYSVLAFRWF WIRRRQFQAVLASSASTLNKARYIRLLVLTAIDMLLFFPIYVGSVSDTIRGAITTSYVSW SYVHTGFSYIPQFSAEVMEMQPSFKARLILSRLVCPISAYIFFAMFGLGQEARQGYKHAV LKALVFCKLRKERQKPIQNHIVANIEVVTFQSRETSGGIDGSPHSEKFSINTPTKYEEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Necab3 shRNA (UAS) - Lentiviral mouseNecab3 shRNA (UAS, GFP) (25)
GTR15282896 1 Vial

Lentiviral mouse Necab3 shRNA (UAS) - Lentiviral mouseNecab3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
3-Bromo-4- (4'-methoxyphenyl) pyridine
OR8275 1 Each

3-Bromo-4- (4'-methoxyphenyl) pyridine

Sign In for Pricing
View Details
CPLX1 Rabbit Polyclonal Antibody
orb2951982-01 50 µg

CPLX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPLX1 Rabbit Polyclonal Antibody
orb2951982-02 100 µg

CPLX1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLP-76 (Phospho-Tyr128) Polyclonal Antibody
orb309042-01 50 μL

SLP-76 (Phospho-Tyr128) Polyclonal Antibody

Sign In for Pricing
View Details
SLP-76 (Phospho-Tyr128) Polyclonal Antibody
orb309042-02 100 µL

SLP-76 (Phospho-Tyr128) Polyclonal Antibody

Sign In for Pricing
View Details