Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histamine H2 receptor (HRH2)

This Recombinant Human Histamine H2 receptor (HRH2) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Histamine H2 receptor, H2R, HH2R, Gastric receptor I

UniProt

P25021

Expression Region

1-359

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nck beta (NCK2) (NM_003581) Human Over-expression Lysate
LS008440-100ug 100 µg

Nck beta (NCK2) (NM_003581) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human GDNF
P1153-.01 10 µg

Recombinant Human GDNF

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans Urease accessory protein UreG (ureG)
MBS1015508-01 0.02 mg (E-Coli)

Recombinant Mycobacterium ulcerans Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans Urease accessory protein UreG (ureG)
MBS1015508-02 0.1 mg (E-Coli)

Recombinant Mycobacterium ulcerans Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans Urease accessory protein UreG (ureG)
MBS1015508-03 0.02 mg (Yeast)

Recombinant Mycobacterium ulcerans Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans Urease accessory protein UreG (ureG)
MBS1015508-04 0.1 mg (Yeast)

Recombinant Mycobacterium ulcerans Urease accessory protein UreG (ureG)

Sign In for Pricing
View Details