Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histamine H2 receptor (HRH2)

This Recombinant Human Histamine H2 receptor (HRH2) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Histamine H2 receptor, H2R, HH2R, Gastric receptor I

UniProt

P25021

Expression Region

1-359

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FYTTD1 Antibody [Allophycocyanin]
NBP2-04090APC 0.1 mL

Rabbit Polyclonal FYTTD1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
CD56 Antibody
V7487-100UG 100 µg

CD56 Antibody

Sign In for Pricing
View Details
PANK4 (Pantothenate Kinase 4, DKFZp547M242, FLJ10782) (MaxLight 550)
249730-ML550 100 µL

PANK4 (Pantothenate Kinase 4, DKFZp547M242, FLJ10782) (MaxLight 550)

Sign In for Pricing
View Details
GALE Rabbit pAb
E45R26668N 50 ul

GALE Rabbit pAb

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Human LILRB1 / CD85j / ILT2 (24-458) Membrane Protein, PaRoom Temperatureial, -hIgG1 Fc tag
MP0572F Each

Magic™ Antibody Discovery - Human LILRB1 / CD85j / ILT2 (24-458) Membrane Protein, PaRoom Temperatureial, -hIgG1 Fc tag

Sign In for Pricing
View Details
4- (4-Cyclopropyl-6-trifluoromethyl-pyrimidin-2-yloxy) -benzaldehyde
LJB41292-01 50 mg

4- (4-Cyclopropyl-6-trifluoromethyl-pyrimidin-2-yloxy) -benzaldehyde

Sign In for Pricing
View Details