Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Medium-wave-sensitive opsin 1 (Opn1mw)

This Recombinant Mouse Medium-wave-sensitive opsin 1 (Opn1mw) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin, M opsin, Medium wavelength-sensitive cone opsin

UniProt

O35599

Expression Region

1-359

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRLTGEQTLDHYEDSTHASIFTYTNSNSTKGPFEGPNYHIAPRWVYHLTSTWMILVVV ASVFTNGLVLAATMRFKKLRHPLNWILVNLAVADLAETIIASTISVVNQIYGYFVLGHPL CVIEGYIVSLCGITGLWSLAIISWERWLVVCKPFGNVRFDAKLATVGIVFSWVWAAIWTA PPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIFPLSIIVLCYLQVWLA IRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATAHPGYAFHPLVAS LPSYFAKSATIYNPIIYVFMNRQFRNCILHLFGKKVDDSSELSSTSKTEVSSVSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp689 (NM_173330) Rat Tagged Lenti ORF Clone
RR213260L3 10 µg

Zfp689 (NM_173330) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CTGLF9P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV721931 1.0 µg DNA

CTGLF9P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Active Anti-Mullerian Hormone (AMH)
MBS2097270-01 0.01 mg

Active Anti-Mullerian Hormone (AMH)

Sign In for Pricing
View Details
Active Anti-Mullerian Hormone (AMH)
MBS2097270-02 0.05 mg

Active Anti-Mullerian Hormone (AMH)

Sign In for Pricing
View Details
Active Anti-Mullerian Hormone (AMH)
MBS2097270-03 0.1 mg

Active Anti-Mullerian Hormone (AMH)

Sign In for Pricing
View Details
Active Anti-Mullerian Hormone (AMH)
MBS2097270-04 0.2 mg

Active Anti-Mullerian Hormone (AMH)

Sign In for Pricing
View Details