Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Histamine H2 receptor (HRH2)

This Recombinant Pongo pygmaeus Histamine H2 receptor (HRH2) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Histamine H2 receptor, H2R, HH2R, Gastric receptor I

UniProt

P61752

Expression Region

1-359

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tube Roller BTUR-101
BTUR-101 1 Unit

Tube Roller BTUR-101

Sign In for Pricing
View Details
Ferritin Heavy Chain (FTH1) (NM_002032) Human Over-expression Lysate
LY400741 100 µg

Ferritin Heavy Chain (FTH1) (NM_002032) Human Over-expression Lysate

Sign In for Pricing
View Details
IFluor® 350 hydrazide
1080-AAT 1 mg

IFluor® 350 hydrazide

Sign In for Pricing
View Details
Unconjugated Rabbit Anti-SJA Antibody
AL-2901-2 2 mL

Unconjugated Rabbit Anti-SJA Antibody

Sign In for Pricing
View Details
MED8 (Center) Rabbit Polyclonal Antibody
AP52660PU-N 400 µL

MED8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hexokinase 1 (HK1) Human Gene Knockout Kit (CRISPR)
KN200464 1 Kit

Hexokinase 1 (HK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details