Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Histamine H2 receptor (HRH2)

This Recombinant Pongo pygmaeus Histamine H2 receptor (HRH2) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Histamine H2 receptor, H2R, HH2R, Gastric receptor I

UniProt

P61752

Expression Region

1-359

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Immunology & Inflammation; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVGLNRRLRNLTNCFIVSL AITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV MDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNETSKGNHTTSKCKVQVNE VYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKRINHISSWKAATIREHKATVTLAAVM GAFIICWFPYFTAFVYRGLRGDDAINEVLEAIVLWLGYANSALNPILYAALNRDFRTGYQ QLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SensiStain™ Anti-PSAP Antibody
HY000223 0.1 mL

SensiStain™ Anti-PSAP Antibody

Sign In for Pricing
View Details
Rfesd (BC030381) Mouse Tagged ORF Clone
MG201179 10 µg

Rfesd (BC030381) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human IGJ/Immunoglobulin J Chain Protein (His Tag)
PKSH030760 100 µg

Recombinant Human IGJ/Immunoglobulin J Chain Protein (His Tag)

Sign In for Pricing
View Details
Cytokeratin, pan (Cocktail PAN-CK), CF594 conjugate, 0.1mg/mL
BNC940999-100 1x 100 µL

Cytokeratin, pan (Cocktail PAN-CK), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neuropeptide Y (NPY) (29-97) Mouse Monoclonal Antibody [Clone ID: 2C10]
AM31928PU-N 50 µg

Neuropeptide Y (NPY) (29-97) Mouse Monoclonal Antibody [Clone ID: 2C10]

Sign In for Pricing
View Details
Mouse IL-17RA Antibody Pair Set
E-KAB-0725 50 µL & 100 µg

Mouse IL-17RA Antibody Pair Set

Sign In for Pricing
View Details