Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 198 (Tmem198)

This Recombinant Mouse Transmembrane protein 198 (Tmem198) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Transmembrane protein 198

UniProt

Q8BG75

Expression Region

1-360

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGTMETLRFQLLPPEPDDTFWGAPCEQPLERRYQALPALVCIMCCLFGVVYCFFGYRCF KAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFL VGLLLGLLLAAAALLGSAPYYQPGSVWGPLGLLLGGGLLCALLTLRWPRPLTTLATAVTG AALIATAADYFAELLLLGRYVVERLRAAPVPPLCWRSWALLALWPLLSLMGVLVQWRVTT ERDSHTEVVISRQRRRVQLMRIRQQEERKEKRRKKRPPRAPPRGPRAPPRPGPPDPAYRR RPVPIKRFNGDVLSPSYIQSFRDRQTGSSLSSFMASPTDTDYEYGSRGPLTACSGPPVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST2 (IL1RL1) Mouse Monoclonal Antibody [Clone ID: OTI1H4C4]
CF810031 100 µg

ST2 (IL1RL1) Mouse Monoclonal Antibody [Clone ID: OTI1H4C4]

Sign In for Pricing
View Details
Spastin (Sp 6C6), Biotin conjugate, 0.1mg/mL
BNCB3070-100 1x 100 µL

Spastin (Sp 6C6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MYL3 Antibody
KC-2728-01 50 μL

MYL3 Antibody

Sign In for Pricing
View Details
MYL3 Antibody
KC-2728-02 100 µL

MYL3 Antibody

Sign In for Pricing
View Details
MYL3 Antibody
KC-2728-03 1 mL

MYL3 Antibody

Sign In for Pricing
View Details
SLC39A3 (Center) Rabbit Polyclonal Antibody
AP53782PU-N 400 µL

SLC39A3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details