Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 198 (Tmem198)

This Recombinant Mouse Transmembrane protein 198 (Tmem198) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Transmembrane protein 198

UniProt

Q8BG75

Expression Region

1-360

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGTMETLRFQLLPPEPDDTFWGAPCEQPLERRYQALPALVCIMCCLFGVVYCFFGYRCF KAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFL VGLLLGLLLAAAALLGSAPYYQPGSVWGPLGLLLGGGLLCALLTLRWPRPLTTLATAVTG AALIATAADYFAELLLLGRYVVERLRAAPVPPLCWRSWALLALWPLLSLMGVLVQWRVTT ERDSHTEVVISRQRRRVQLMRIRQQEERKEKRRKKRPPRAPPRGPRAPPRPGPPDPAYRR RPVPIKRFNGDVLSPSYIQSFRDRQTGSSLSSFMASPTDTDYEYGSRGPLTACSGPPVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-fluorescence quenching sealing agent (Ready to use, DABCO, including DAPI)
EGY078 100 Tests

Anti-fluorescence quenching sealing agent (Ready to use, DABCO, including DAPI)

Sign In for Pricing
View Details
4-Methoxyphenyl 2,3:4,6-di-O-benzylidene-a-D-mannopyranoside
294172-01 1 g

4-Methoxyphenyl 2,3:4,6-di-O-benzylidene-a-D-mannopyranoside

Sign In for Pricing
View Details
4-Methoxyphenyl 2,3:4,6-di-O-benzylidene-a-D-mannopyranoside
294172-02 2 g

4-Methoxyphenyl 2,3:4,6-di-O-benzylidene-a-D-mannopyranoside

Sign In for Pricing
View Details
4-Methoxyphenyl 2,3:4,6-di-O-benzylidene-a-D-mannopyranoside
294172-03 5 g

4-Methoxyphenyl 2,3:4,6-di-O-benzylidene-a-D-mannopyranoside

Sign In for Pricing
View Details
1810013D10Rik sgRNA CRISPR Lentivector set (Mouse)
K3124701 3x 1.0 µg

1810013D10Rik sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
FLJ11506, CT (AAGAB, Alpha-and gamma-adaptin-binding protein p34) (Biotin)
MBS6299425-01 0.2 mL

FLJ11506, CT (AAGAB, Alpha-and gamma-adaptin-binding protein p34) (Biotin)

Sign In for Pricing
View Details