Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 198 (Tmem198)

This Recombinant Mouse Transmembrane protein 198 (Tmem198) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Transmembrane protein 198

UniProt

Q8BG75

Expression Region

1-360

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGTMETLRFQLLPPEPDDTFWGAPCEQPLERRYQALPALVCIMCCLFGVVYCFFGYRCF KAVLFLTGLLFGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFL VGLLLGLLLAAAALLGSAPYYQPGSVWGPLGLLLGGGLLCALLTLRWPRPLTTLATAVTG AALIATAADYFAELLLLGRYVVERLRAAPVPPLCWRSWALLALWPLLSLMGVLVQWRVTT ERDSHTEVVISRQRRRVQLMRIRQQEERKEKRRKKRPPRAPPRGPRAPPRPGPPDPAYRR RPVPIKRFNGDVLSPSYIQSFRDRQTGSSLSSFMASPTDTDYEYGSRGPLTACSGPPVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRY Antibody
E51A01103 100 µL

SRY Antibody

Sign In for Pricing
View Details
Anti-Fruit fly Tea Antibody
DZ41504 200 µL/Vial

Anti-Fruit fly Tea Antibody

Sign In for Pricing
View Details
Hantavirus Virus (Puumala) (MaxLight 750) discontinued
H1810-25C-ML750 100 µL

Hantavirus Virus (Puumala) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral human APOD shRNA (UAS) - Lentiviral human APOD shRNA (UAS, RFP) (100)
GTR15137940 1 Vial

Lentiviral human APOD shRNA (UAS) - Lentiviral human APOD shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_112 (MPN_112)
MBS1173030 Inquire

Recombinant Mycoplasma pneumoniae Uncharacterized protein MPN_112 (MPN_112)

Sign In for Pricing
View Details
Recombinant Mouse Protein kinase-like protein SgK196 (Sgk196), partial
MBS7079461 Inquire

Recombinant Mouse Protein kinase-like protein SgK196 (Sgk196), partial

Sign In for Pricing
View Details