Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 15 (Gpr15)

This Recombinant Mouse G-protein coupled receptor 15 (Gpr15) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

G-protein coupled receptor 15

UniProt

Q0VDU3

Expression Region

1-360

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPATALLIVDYYDYTSPDPPFLETPSHLSYTSVFLPIFYTVVFLTGVVGNFILMIALHF KRGNRRLIDIFIINLAASDFIFLVTVPLWMDKEASLGLWRTGSFLCKGSSYVISVNMHCS VFLLTCMSMDRYLAIMHPALAKRLRRRSSAYAVCAVVWIISCVLGLPTLLSRELTHIEGK PYCAEKKPTSLKLMWGLVALITTFFVPLLSIVTCYCCITRRLCAHYQQSGKHNKKLKKSI KIVIIAVAAFTVSWVPFNTFKLLAIVSGFQPEGLFHSEALQLAMNVTGPLAFASSCVNPL IYYVFDSYIRRAIVRCLCPCLKTHNFGSSTETSDSHLTKALSNFIHAEDFIRRRKRSVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alternative Block ELISA Blocking Buffer
6301 1 L

Alternative Block ELISA Blocking Buffer

Sign In for Pricing
View Details
ATG10 Antibody (Biotin)
KB-7524-01 50 μL

ATG10 Antibody (Biotin)

Sign In for Pricing
View Details
ATG10 Antibody (Biotin)
KB-7524-02 100 µL

ATG10 Antibody (Biotin)

Sign In for Pricing
View Details
ATG10 Antibody (Biotin)
KB-7524-03 1 mL

ATG10 Antibody (Biotin)

Sign In for Pricing
View Details
Human Luteinizing Hormone beta (LHB) activation kit by CRISPRa
GA102689 1 Kit

Human Luteinizing Hormone beta (LHB) activation kit by CRISPRa

Sign In for Pricing
View Details
BAF180 Recombinant Rabbit Monoclonal Antibody [PSH02-34]
HA721811 100 µL

BAF180 Recombinant Rabbit Monoclonal Antibody [PSH02-34]

Sign In for Pricing
View Details