Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 15 (Gpr15)

This Recombinant Mouse G-protein coupled receptor 15 (Gpr15) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

G-protein coupled receptor 15

UniProt

Q0VDU3

Expression Region

1-360

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPATALLIVDYYDYTSPDPPFLETPSHLSYTSVFLPIFYTVVFLTGVVGNFILMIALHF KRGNRRLIDIFIINLAASDFIFLVTVPLWMDKEASLGLWRTGSFLCKGSSYVISVNMHCS VFLLTCMSMDRYLAIMHPALAKRLRRRSSAYAVCAVVWIISCVLGLPTLLSRELTHIEGK PYCAEKKPTSLKLMWGLVALITTFFVPLLSIVTCYCCITRRLCAHYQQSGKHNKKLKKSI KIVIIAVAAFTVSWVPFNTFKLLAIVSGFQPEGLFHSEALQLAMNVTGPLAFASSCVNPL IYYVFDSYIRRAIVRCLCPCLKTHNFGSSTETSDSHLTKALSNFIHAEDFIRRRKRSVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fatty Acid Synthase Antibody
KC-6199-01 50 μL

Fatty Acid Synthase Antibody

Sign In for Pricing
View Details
Fatty Acid Synthase Antibody
KC-6199-02 100 µL

Fatty Acid Synthase Antibody

Sign In for Pricing
View Details
Fatty Acid Synthase Antibody
KC-6199-03 1 mL

Fatty Acid Synthase Antibody

Sign In for Pricing
View Details
PDE5A Antibody
KC-219-01 50 μL

PDE5A Antibody

Sign In for Pricing
View Details
PDE5A Antibody
KC-219-02 100 µL

PDE5A Antibody

Sign In for Pricing
View Details