Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine G-protein coupled receptor 183 (GPR183)

This Recombinant Bovine G-protein coupled receptor 183 (GPR183) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

G-protein coupled receptor 183

UniProt

Q1RMI1

Expression Region

1-360

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIKMDNFTTPSAASLESDCDLYAHHHTARILMPLHYSIVFIIGLVGNLLALIVIIQNRK KINSTTLYSTNLVISDILFTTALPTRIAYYALGFDWRIGDALCRITALVFYINTYAGVNF MTCLSIDRFFAVVHPLRYNKIKRIEHAKCICIFVWILVFGQTLPLLINPMSKQEAERTTC MEYPNFEETKSLPWILLGACFIGYVLPLVIILICYSQICCKLFKTAKQNPLTEKSGVNKK ALNTIIFIIVVFVVCFTPYHVAIIQHMIKKLRLPGLLECSQRHSFQISLHFTVCLMNFNC CMDPFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTETQMMIHSKSLNGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-100 1x 100 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL
BNC040040-500 1x 500 µL

CD35 / CR1 (E11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF647 conjugate, 0.1mg/mL
BNC470485-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (SPN/1094), CF405S conjugate, 0.1mg/mL
BNC041094-500 1x 500 µL

CD43 (SPN/1094), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details