Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1L1 (OR1L1)

This Recombinant Human Olfactory receptor 1L1 (OR1L1) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Olfactory receptor 1L1, Olfactory receptor 1L2, Olfactory receptor 9-C, OR9-C, Olfactory receptor OR9-27

UniProt

Q8NH94

Expression Region

1-360

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERNHNPDNCNVLNFFFADKKNKRRNFGQIVSDVGRICYSVSLSLGEPTTMGRNNLTRPS EFILLGLSSRPEDQKPLFAVFLPIYLITVIGNLLIILAIRSDTRLQTPMYFFLSILSFVD ICYVTVIIPKMLVNFLSETKTISYSECLTQMYFFLAFGNTDSYLLAAMAIDRYVAICNPF HYITIMSHRCCVLLLVLSFCIPHFHSLLHILLTNQLIFCASNVIHHFFCDDQPVLKLSCS SHFVKEITVMTEGLAVIMTPFSCIIISYLRILITVLKIPSAAGKRKAFSTCGSHLTVVTL FYGSISYLYFQPLSNYTVKDQIATIIYTVLTPMLNPFIYSLRNKDMKQGLAKLMHRMKCQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitronaphthalene
TRC-N496860-250MG 250 mg

2-Nitronaphthalene

Sign In for Pricing
View Details
Protein A PCR Plates - semi skirted
PCR960206-PA 10 Plates

Protein A PCR Plates - semi skirted

Sign In for Pricing
View Details
SPANXN4 (NM_001009613) Human Recombinant Protein
TP316287 20 µg

SPANXN4 (NM_001009613) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag)
PKSH030283-01 100 µg

Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag)

Sign In for Pricing
View Details
Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag)
PKSH030283-02 1 mg

Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag)

Sign In for Pricing
View Details
Golgi Complex (Marker for Human Cells) Mouse Monoclonal Antibody [Clone ID: 371-4]
AM33312PU-S 100 µg

Golgi Complex (Marker for Human Cells) Mouse Monoclonal Antibody [Clone ID: 371-4]

Sign In for Pricing
View Details