Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cannabinoid receptor 2 (Cnr2)

This Recombinant Rat Cannabinoid receptor 2 (Cnr2) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Cannabinoid receptor 2, CB-2, CB2, rCB2

UniProt

Q9QZN9

Expression Region

1-360

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM184B qPCR Primer Pair
QH38489S 200 Tests

Human FAM184B qPCR Primer Pair

Sign In for Pricing
View Details
EIF2S1 siRNA (Human)
orb1866898-01 15 nmol

EIF2S1 siRNA (Human)

Sign In for Pricing
View Details
EIF2S1 siRNA (Human)
orb1866898-02 30 nmol

EIF2S1 siRNA (Human)

Sign In for Pricing
View Details
EDIL3 Polyclonal Antibody
MBS2519992-01 0.02 mL

EDIL3 Polyclonal Antibody

Sign In for Pricing
View Details
EDIL3 Polyclonal Antibody
MBS2519992-02 0.06 mL

EDIL3 Polyclonal Antibody

Sign In for Pricing
View Details
EDIL3 Polyclonal Antibody
MBS2519992-03 0.12 mL

EDIL3 Polyclonal Antibody

Sign In for Pricing
View Details