Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cannabinoid receptor 2 (Cnr2)

This Recombinant Rat Cannabinoid receptor 2 (Cnr2) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Cannabinoid receptor 2, CB-2, CB2, rCB2

UniProt

Q9QZN9

Expression Region

1-360

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZFP28 Knockout HEK293T cell line
GTR15406301 1 Vial

Human ZFP28 Knockout HEK293T cell line

Sign In for Pricing
View Details
Mouse Anti-Human Lambda-HRP
9180-05 1.0 mL

Mouse Anti-Human Lambda-HRP

Sign In for Pricing
View Details
Multi-drug 3 drugs Rapid Test Device – Urine
D-DOAM3U 10 Tests

Multi-drug 3 drugs Rapid Test Device – Urine

Sign In for Pricing
View Details
Git2 (NM_019834) Mouse Untagged Clone
MC220773 10 µg

Git2 (NM_019834) Mouse Untagged Clone

Sign In for Pricing
View Details
Rabbit Monoclonal Carbonic Anhydrase IV/CA4 Antibody (039) [DyLight 755]
NBP2-89518IR 0.1 mL

Rabbit Monoclonal Carbonic Anhydrase IV/CA4 Antibody (039) [DyLight 755]

Sign In for Pricing
View Details
Rat Monoclonal MARCO Antibody (579511) [PE/Cy7]
FAB2956PECY7 0.1 mL

Rat Monoclonal MARCO Antibody (579511) [PE/Cy7]

Sign In for Pricing
View Details