Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cannabinoid receptor 2 (Cnr2)

This Recombinant Rat Cannabinoid receptor 2 (Cnr2) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

Cannabinoid receptor 2, CB-2, CB2, rCB2

UniProt

Q9QZN9

Expression Region

1-360

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB2 (2O14) Mouse Monoclonal antibody
E28PE1574 100 µL

SERPINB2 (2O14) Mouse Monoclonal antibody

Sign In for Pricing
View Details
L-Aspartic acid
abx082144-01 25 g

L-Aspartic acid

Sign In for Pricing
View Details
L-Aspartic acid
abx082144-02 100 g

L-Aspartic acid

Sign In for Pricing
View Details
α-actinin-1 shRNA Plasmid (h)
sc-43095-SH 20 µg

α-actinin-1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Human ITIH5 (Inter Alpha-Globulin Inhibitor H5) ELISA Kit
EK242938 96 Well

Human ITIH5 (Inter Alpha-Globulin Inhibitor H5) ELISA Kit

Sign In for Pricing
View Details
ASC/TMS1 Polyclonal Antibody, APC Conjugated
bs-24399R-APC 100 µL

ASC/TMS1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details