Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C chemokine receptor-like 2 (Ccrl2)

This Recombinant Mouse C-C chemokine receptor-like 2 (Ccrl2) spans the amino acid sequence from region 1-360.

Product Specifications

Product Name Alternative

C-C chemokine receptor-like 2, Chemokine receptor CCR11, G-protein coupled beta chemokine receptor, Lipopolysacharide-inducible C-C chemokine receptor, L-CCR

UniProt

O35457

Expression Region

1-360

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCCAVFAVGLLDNVLAVF ILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPGNGTCKVLVGLHSSGLY SEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMATALSLPESVFYEPRMER QKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFIICCRQLRRRQSFRERQYDL HKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYHLDASVQVTQLVATTHCCVN PLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPREGHGRPIELYSNLHQRQDII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-100 1x 100 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-100 1x 100 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details