Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Proteinase-activated receptor 2 (F2RL1)

This Recombinant Bovine Proteinase-activated receptor 2 (F2RL1) spans the amino acid sequence from region 35-395.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 2, PAR-2, Coagulation factor II receptor-like 1, Thrombin receptor-like 1

UniProt

Q2HJA4

Expression Region

35-395

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLIGNVDNSPVVAGRGVTVKPGFSVDEFSTSVLTGKLTTVFLPVVYTIVFVVGLPSNGMA LWVFLFRTKKKHPAVIYMANLALADLLSVTWFPLKIAYHIHGNNWIYGESLCKVLIGFFY GNMYCSILFMTCLSVQRYWVIVNPMVHPKKQANIAIGVSLGIWLLILLLTIPLYVVKQTS YIRALNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRTLQSSAMDE SSGKKRRRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKTRGQSHVYALYIVALCLSTLN SCIDPFVYYFISQDFRDHAKNALLCRSVRTVKRMQVSLSSKKFSGKSSSYSSSSTSVKGS Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-100 1x 100 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details