Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse P2Y purinoceptor 4 (P2ry4)

This Recombinant Mouse P2Y purinoceptor 4 (P2ry4) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

P2Y purinoceptor 4, P2Y4

UniProt

Q9JJS7

Expression Region

1-361

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSADSLLFTSLGPSPSSGDGDCKFNEEFKFILLPLSYAVVFVLGLALNAPTLWLFLFRL RPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGFCKFVRFLFYWNLYCSVL FLTCISVHRYMGICHPLRAIRWGRPRFAGLLCLGVWLVVAGCLVPNLFFVTTNANGTTIL CHDTTLPEEFDHYVYFSSTIMVLLFGFPFLITLVCYGLMARRLYRPLPGAGQSSSRLRSL RTIAVVLTVFAVCFVPFHITRTIYYLARLLNAECRVLNIVNVVYKVTRPLASANSCLDPV LYLFTGDKYRNQLQQLCRGSTPKRRTTASSLALVTLHEESISRWADIHQDSIFPAYEGDR L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 13 (KLK13, Kallikrein-related Peptidase 13, Kallikrein-like Protein 4, KLKL4, KLK-L4, DKFZp586J1923) (MaxLight 750) discontinued
128711-ML750 100 µL

Kallikrein 13 (KLK13, Kallikrein-related Peptidase 13, Kallikrein-like Protein 4, KLKL4, KLK-L4, DKFZp586J1923) (MaxLight 750) discontinued

Sign In for Pricing
View Details
HAV Real Time RT-PCR Kit
GWB-LRB012 25 Tests

HAV Real Time RT-PCR Kit

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Ornithine carbamoyltransferase (argF)
MBS1441278-01 0.02 mg (E-Coli)

Recombinant Bordetella pertussis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Ornithine carbamoyltransferase (argF)
MBS1441278-02 0.02 mg (Yeast)

Recombinant Bordetella pertussis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Ornithine carbamoyltransferase (argF)
MBS1441278-03 0.1 mg (E-Coli)

Recombinant Bordetella pertussis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details
Recombinant Bordetella pertussis Ornithine carbamoyltransferase (argF)
MBS1441278-04 0.1 mg (Yeast)

Recombinant Bordetella pertussis Ornithine carbamoyltransferase (argF)

Sign In for Pricing
View Details