Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 52 (Gpr52)

This Recombinant Mouse Probable G-protein coupled receptor 52 (Gpr52) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 52

UniProt

P0C5J4

Expression Region

1-361

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESRWTEWRILNMSSSIVNVSEHHSCPLGFGHYSVEDVCIFETVVIVLLTFLIISGNLT VIFVFHCAPLLHHYTTSYFIQTMAYADLLVGVTCLVPTLSLLHYSTGVHESLTCQVFGYI ISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIIMIWIYSCLIFLPSFFGW GKPGYHGDIFEWCATSWLTSAYFTCFIVCLLYAPAALVVCFTYFHIFKICRQHTKEINDR RARFPSHEVEASREAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSF LTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCVCAKDQEAQDPKPRRRANSCS I

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carbonic Anhydrase-Related Protein 10 (CA10) Protein
abx692969-01 10 µg

Human Carbonic Anhydrase-Related Protein 10 (CA10) Protein

Sign In for Pricing
View Details
Human Carbonic Anhydrase-Related Protein 10 (CA10) Protein
abx692969-02 50 µg

Human Carbonic Anhydrase-Related Protein 10 (CA10) Protein

Sign In for Pricing
View Details
Human Opi ELISA Kit
ELA-E1779h 96 Tests

Human Opi ELISA Kit

Sign In for Pricing
View Details
Josephin-1 Rabbit pAb, IRDye 800CW conjugated
orb2844905 100 µL

Josephin-1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Myosin Light Chain 12B (MYL12B) Antibody (FITC)
abx271224-01 200 µL

Myosin Light Chain 12B (MYL12B) Antibody (FITC)

Sign In for Pricing
View Details
Myosin Light Chain 12B (MYL12B) Antibody (FITC)
abx271224-02 1 mL

Myosin Light Chain 12B (MYL12B) Antibody (FITC)

Sign In for Pricing
View Details