Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 52 (Gpr52)

This Recombinant Mouse Probable G-protein coupled receptor 52 (Gpr52) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 52

UniProt

P0C5J4

Expression Region

1-361

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESRWTEWRILNMSSSIVNVSEHHSCPLGFGHYSVEDVCIFETVVIVLLTFLIISGNLT VIFVFHCAPLLHHYTTSYFIQTMAYADLLVGVTCLVPTLSLLHYSTGVHESLTCQVFGYI ISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIIMIWIYSCLIFLPSFFGW GKPGYHGDIFEWCATSWLTSAYFTCFIVCLLYAPAALVVCFTYFHIFKICRQHTKEINDR RARFPSHEVEASREAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSF LTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCVCAKDQEAQDPKPRRRANSCS I

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas Aeruginosa sstT Protein (aa 1-429)
VAng-Cr0712-1mgEcoli 1 mg (E. coli)

Recombinant Pseudomonas Aeruginosa sstT Protein (aa 1-429)

Sign In for Pricing
View Details
Human RPA2 shRNA Plasmid
abx954112-01 150 µg

Human RPA2 shRNA Plasmid

Sign In for Pricing
View Details
Human RPA2 shRNA Plasmid
abx954112-02 300 µg

Human RPA2 shRNA Plasmid

Sign In for Pricing
View Details
Rat Troponin I, slow skeletal muscle (TNNI1) ELISA kit
CK-bio-20094-01 48 Tests

Rat Troponin I, slow skeletal muscle (TNNI1) ELISA kit

Sign In for Pricing
View Details
Rat Troponin I, slow skeletal muscle (TNNI1) ELISA kit
CK-bio-20094-02 96 Tests

Rat Troponin I, slow skeletal muscle (TNNI1) ELISA kit

Sign In for Pricing
View Details
Rat Troponin I, slow skeletal muscle (TNNI1) ELISA kit
CK-bio-20094-03 5x 96 Tests

Rat Troponin I, slow skeletal muscle (TNNI1) ELISA kit

Sign In for Pricing
View Details