Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 52 (Gpr52)

This Recombinant Mouse Probable G-protein coupled receptor 52 (Gpr52) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 52

UniProt

P0C5J4

Expression Region

1-361

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNESRWTEWRILNMSSSIVNVSEHHSCPLGFGHYSVEDVCIFETVVIVLLTFLIISGNLT VIFVFHCAPLLHHYTTSYFIQTMAYADLLVGVTCLVPTLSLLHYSTGVHESLTCQVFGYI ISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIIMIWIYSCLIFLPSFFGW GKPGYHGDIFEWCATSWLTSAYFTCFIVCLLYAPAALVVCFTYFHIFKICRQHTKEINDR RARFPSHEVEASREAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSF LTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCVCAKDQEAQDPKPRRRANSCS I

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX2 Antibody, mAb, Rabbit
A03286-100 100 µL

PAX2 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
BC049352-set siRNA/shRNA/RNAi Lentivector (Mouse)
13152094 4x 500 ng

BC049352-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Synaptopodin (SYNPO) Magnetic Fluorescence Assay Kit
MBS2158931-01 96 Tests

Synaptopodin (SYNPO) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Synaptopodin (SYNPO) Magnetic Fluorescence Assay Kit
MBS2158931-02 5x 96 Tests

Synaptopodin (SYNPO) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Synaptopodin (SYNPO) Magnetic Fluorescence Assay Kit
MBS2158931-03 10x 96 Tests

Synaptopodin (SYNPO) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Bphl Mouse qPCR Template Standard (NM_026512)
MK201781 1 Kit

Bphl Mouse qPCR Template Standard (NM_026512)

Sign In for Pricing
View Details