Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 2 (F2rl1)

This Recombinant Mouse Proteinase-activated receptor 2 (F2rl1) spans the amino acid sequence from region 39-399.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 2, PAR-2, Coagulation factor II receptor-like 1, G-protein coupled receptor 11, Thrombin receptor-like 1

UniProt

P55086

Expression Region

39-399

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLIGRLETQPPITGKGVPVEPGFSIDEFSASILTGKLTTVFLPVVYIIVFVIGLPSNGMA LWIFLFRTKKKHPAVIYMANLALADLLSVIWFPLKISYHLHGNNWVYGEALCKVLIGFFY GNMYCSILFMTCLSVQRYWVIVNPMGHPRKKANIAVGVSLAIWLLIFLVTIPLYVMKQTI YIPALNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLFPALLTASAYVLMIKTLRSSAMDE HSEKKRQRAIRLIITVLAMYFICFAPSNLLLVVHYFLIKTQRQSHVYALYLVALCLSTLN SCIDPFVYYFVSKDFRDHARNALLCRSVRTVNRMQISLSSNKFSRKSGSYSSSSTSVKTS Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Unc50 Mouse Gene Knockout Kit (CRISPR)
KN518706 1 Kit

Unc50 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mmp10 Mouse Gene Knockout Kit (CRISPR)
KN310163LP 1 Kit

Mmp10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (N/A), CF568 conjugate, 0.1mg/mL
BNC681816-100 1x 100 µL

Histone H1 (Pan Nuclear Marker) (N/A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TMC1 activation kit by CRISPRa
GA114646 1 Kit

Human TMC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF405S conjugate, 0.1mg/mL
BNC040046-100 1x 100 µL

Pgp9.5 (UCHL-1) (31A3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Endothelin 3 (EDN3) (NM_207034) Human Over-expression Lysate
LC404139 20 µg

Endothelin 3 (EDN3) (NM_207034) Human Over-expression Lysate

Sign In for Pricing
View Details