Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 2 (F2rl1)

This Recombinant Mouse Proteinase-activated receptor 2 (F2rl1) spans the amino acid sequence from region 39-399.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 2, PAR-2, Coagulation factor II receptor-like 1, G-protein coupled receptor 11, Thrombin receptor-like 1

UniProt

P55086

Expression Region

39-399

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLIGRLETQPPITGKGVPVEPGFSIDEFSASILTGKLTTVFLPVVYIIVFVIGLPSNGMA LWIFLFRTKKKHPAVIYMANLALADLLSVIWFPLKISYHLHGNNWVYGEALCKVLIGFFY GNMYCSILFMTCLSVQRYWVIVNPMGHPRKKANIAVGVSLAIWLLIFLVTIPLYVMKQTI YIPALNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLFPALLTASAYVLMIKTLRSSAMDE HSEKKRQRAIRLIITVLAMYFICFAPSNLLLVVHYFLIKTQRQSHVYALYLVALCLSTLN SCIDPFVYYFVSKDFRDHARNALLCRSVRTVNRMQISLSSNKFSRKSGSYSSSSTSVKTS Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NQO1 Human Gene Knockout Kit (CRISPR)
KN200620BN 1 Kit

NQO1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
STAT3 Rabbit Polyclonal Antibody
AP06328PU-N 100 µg

STAT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STEAP1 (NM_012449) Human Recombinant Protein
TP303970L 1 mg

STEAP1 (NM_012449) Human Recombinant Protein

Sign In for Pricing
View Details
2',3'-cGAMP-Cy5 conjugate
20318-AAT 100 µg

2',3'-cGAMP-Cy5 conjugate

Sign In for Pricing
View Details
FNDC9 (NM_001001343) Human Over-expression Lysate
LY424328 100 µg

FNDC9 (NM_001001343) Human Over-expression Lysate

Sign In for Pricing
View Details
REM2 Human qPCR Primer Pair (NM_173527)
HP218346 200 Reactions

REM2 Human qPCR Primer Pair (NM_173527)

Sign In for Pricing
View Details