Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 2 (F2rl1)

This Recombinant Mouse Proteinase-activated receptor 2 (F2rl1) spans the amino acid sequence from region 39-399.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 2, PAR-2, Coagulation factor II receptor-like 1, G-protein coupled receptor 11, Thrombin receptor-like 1

UniProt

P55086

Expression Region

39-399

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLIGRLETQPPITGKGVPVEPGFSIDEFSASILTGKLTTVFLPVVYIIVFVIGLPSNGMA LWIFLFRTKKKHPAVIYMANLALADLLSVIWFPLKISYHLHGNNWVYGEALCKVLIGFFY GNMYCSILFMTCLSVQRYWVIVNPMGHPRKKANIAVGVSLAIWLLIFLVTIPLYVMKQTI YIPALNITTCHDVLPEEVLVGDMFNYFLSLAIGVFLFPALLTASAYVLMIKTLRSSAMDE HSEKKRQRAIRLIITVLAMYFICFAPSNLLLVVHYFLIKTQRQSHVYALYLVALCLSTLN SCIDPFVYYFVSKDFRDHARNALLCRSVRTVNRMQISLSSNKFSRKSGSYSSSSTSVKTS Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taletrectinib Adipate
TRC-T757780-100MG 100 mg

Taletrectinib Adipate

Sign In for Pricing
View Details
DPP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A8]
TA503286AM 100 µL

DPP3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A8]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB526793 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Guanyl Urea Sulfate
TRC-G844500-5G 5 g

Guanyl Urea Sulfate

Sign In for Pricing
View Details
BMZERO™, 500 ml
0401 500 mL

BMZERO™, 500 ml

Sign In for Pricing
View Details
HAO1 (NM_017545) Human Recombinant Protein
TP720251M 50 µg

HAO1 (NM_017545) Human Recombinant Protein

Sign In for Pricing
View Details